PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_30500V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MIKC_MADS
Protein Properties Length: 317aa    MW: 35432.9 Da    PI: 8.8069
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_30500V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.38.8e-2861111151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                        k+ien + rqvtfskRr g+lKKA+EL vLCdaeva+iifsstgkl+e++s
  Pp3c1_30500V3.1.p  61 KKIENPTSRQVTFSKRRGGLLKKAHELAVLCDAEVALIIFSSTGKLFEFAS 111
                        68***********************************************86 PP

2bZIP_120.11.3e-061832271757
                        HHHHHHHHHH....HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  17 ArrsRqRKka....eieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                        A+r R+RK +    eie+L++k   L+aeN++L+k+l + k++++
  Pp3c1_30500V3.1.p 183 ASRVRARKNQllleEIEQLRQKELDLQAENEDLRKKLAHVKETAE 227
                        99******74333399*************************9876 PP

3K-box86.84.2e-291342201399
              K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        +   + +e+ kL++++e +q++qR++lGedL+ L++ +L qLeqqL+ + +++R++Kn+llle+ie+l++ke +lq en++Lrkkl+
  Pp3c1_30500V3.1.p 134 NVDFMGREVVKLRQQLERMQHSQRQMLGEDLQVLTVSDLLQLEQQLDVGASRVRARKNQLLLEEIEQLRQKELDLQAENEDLRKKLA 220
                        6778999******************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.01153113IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-4253112IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.93E-3454141IPR002100Transcription factor, MADS-box
CDDcd002654.52E-4554128No hitNo description
PROSITE patternPS00350055109IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-305575IPR002100Transcription factor, MADS-box
PfamPF003197.5E-2662109IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-307590IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-3090111IPR002100Transcription factor, MADS-box
PfamPF014864.6E-26135219IPR002487Transcription factor, K-box
PROSITE profilePS5129715.678135225IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MMTASGQYRS LQRFCSQRNS DSWRTTHGGA GRVVLDSSSF VGKVDPPKER EVMGRGKIEI  60
KKIENPTSRQ VTFSKRRGGL LKKAHELAVL CDAEVALIIF SSTGKLFEFA SSGSMRDILE  120
RYSKCPDGVQ TTGNVDFMGR EVVKLRQQLE RMQHSQRQML GEDLQVLTVS DLLQLEQQLD  180
VGASRVRARK NQLLLEEIEQ LRQKELDLQA ENEDLRKKLA HVKETAEVSG HTGTSESPSQ  240
VASASAYETG GISAQVTMVY PTHPNLRDPQ TSQTSLHLGL FPESFVPNTS RRPSQRSPTD  300
PEGESSIRWE RYRGQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A4e-1954123169Myocyte-specific enhancer factor 2A
3mu6_B4e-1954123169Myocyte-specific enhancer factor 2A
3mu6_C4e-1954123169Myocyte-specific enhancer factor 2A
3mu6_D4e-1954123169Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1913231e-138DQ191323.1 Physcomitrella patens classical MIKC-type MADS-box gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001774085.10.0MIKCC MADS-domain protein PpMADS-S
SwissprotQ9XGJ45e-58GGM13_GNEGN; MADS-box protein GGM13
TrEMBLA9T6250.0A9T625_PHYPA; MIKCC MADS-domain protein PpMADS-S
STRINGPP1S209_130V6.11e-144(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.16e-49MIKC_MADS family protein